PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G21660.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 347aa    MW: 37848.7 Da    PI: 9.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G21660.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.9e-3354108155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  OPUNC06G21660.2  54 KPRLRWTVELHDRFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 108
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-3251109IPR009057Homeodomain-like
PROSITE profilePS5129411.87651111IPR017930Myb domain
SuperFamilySSF466891.79E-1653110IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-2454109IPR006447Myb domain, plants
PfamPF002492.0E-756106IPR001005SANT/Myb domain
PfamPF143792.2E-24147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MFPSSSPSPS SSSKKQQQQQ QLSGGGGGAA ASSNDRPPLC VQGDSGLVLT TDPKPRLRWT  60
VELHDRFVDA VTQLGGPDKA TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QHKDFNDHSV  120
KDAMDMQRNA ASSSSGIMGR SMNDRSVHVN EALRMKMEVQ RRFHEQLEVQ KHLQMRVEAQ  180
GKYMQSILEK AYQAISSGDC ATWHAGYKSL GNQAVLDIGS SMSFPSLQDL QLYGGSHLDL  240
HQQQMERSPM DSFLAFNYSS TGKSPVVWPG ADDGEPAKIS GDQLQMAAPS MMMDATTMSG  300
GDSMGSKGFE GQMSSKLDMR SPPQQQTGSE RMSSPIVGAK ARNISYG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1195880.0AK119588.1 Oryza sativa Japonica Group cDNA clone:002-117-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642102.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK52e-82APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0E0LEE30.0A0A0E0LEE3_ORYPU; Uncharacterized protein
STRINGLOC_Os06g45410.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.23e-83G2-like family protein